SCOPe 2.08: Domain d6xcoe2: 6xco E:127-253

Lineage for d6xcoe2 (6xco E:127-253)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d6xcoe2: 6xco E:127-253 [417056]
   Other proteins in same PDB: d6xcoa1, d6xcoe1
   automated match to d3gsnb2
   complexed with cac, gol, nag

Details for d6xcoe2

PDB Entry: 6xco, 2.9 Å

PDB Description: immune receptor complex

PDB Compounds: (E:) T-CELL-RECEPTOR, A1.9-beta chain

SCOPe Domain Sequences for d6xcoe2:

Sequence; same for both SEQRES and ATOM records:

>d6xcoe2 b.1.1.2 (E:127-253) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lnkvfppevavfepseaeishtqkatlvclatgffpdhvelswwvngkevhsgvctdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawgra

Timeline for d6xcoe2:

• d6xcoe2 is new in SCOPe 2.08-stable