Lineage for d1byga_ (1byg A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. Protein Carboxyl-terminal src kinase (csk) [56164] (1 species)
    PTK group; CSK subfamily; non-membrane spanning protein tyrosine kinase
  7. Species Human (Homo sapiens) [TaxId:9606] [56165] (4 PDB entries)
  8. Domain d1byga_: 1byg A: [41705]
    complexed with stu

Details for d1byga_

PDB Entry: 1byg (more details), 2.4 Å

PDB Description: kinase domain of human c-terminal src kinase (csk) in complex with inhibitor staurosporine
PDB Compounds: (A:) protein (c-terminal src kinase)

SCOPe Domain Sequences for d1byga_:

Sequence, based on SEQRES records: (download)

>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]}
gwalnmkelkllqtigkgefgdvmlgdyrgnkvavkcikndataqaflaeasvmtqlrhs
nlvqllgviveekgglyivteymakgslvdylrsrgrsvlggdcllkfsldvceameyle
gnnfvhrdlaarnvlvsednvakvsdfgltkeasstqdtgklpvkwtapealrekkfstk
sdvwsfgillweiysfgrvpypriplkdvvprvekgykmdapdgcppavyevmkncwhld
aamrpsflqlreqlehikthel

Sequence, based on observed residues (ATOM records): (download)

>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]}
gwalnmkelkllqtigkgefgdvmlgdyrgnkvavkcikndaqaflaeasvmtqlrhsnl
vqllgviveeglyivteymakgslvdylrsrgrsvlggdcllkfsldvceameylegnnf
vhrdlaarnvlvsednvakvsdfgllpvkwtapealrekkfstksdvwsfgillweiysf
grvpypriplkdvvprvekgykmdapdgcppavyevmkncwhldaamrpsflqlreqleh
ikthel

SCOPe Domain Coordinates for d1byga_ are not available.

Timeline for d1byga_: