Lineage for d1gaga_ (1gag A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218179Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2219815Protein Insulin receptor [56162] (1 species)
    PTK group; InsR subfamily; membrane spanning protein tyrosine kinase
  7. 2219816Species Human (Homo sapiens) [TaxId:9606] [56163] (18 PDB entries)
  8. 2219833Domain d1gaga_: 1gag A: [41704]
    complexed with 112, mg

Details for d1gaga_

PDB Entry: 1gag (more details), 2.7 Å

PDB Description: crystal structure of the insulin receptor kinase in complex with a bisubstrate inhibitor
PDB Compounds: (A:) insulin receptor, tyrosine kinase domain

SCOPe Domain Sequences for d1gaga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gaga_ d.144.1.7 (A:) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}
ssvfvpdewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesaslre
rieflneasvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaennpg
rppptlqemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdiyet
dyyrkggkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneqvlk
fvmdggyldqpdncpervtdlmrmcwqfnpkmrptfleivnllkddlhpsfpevsffhse
enk

SCOPe Domain Coordinates for d1gaga_:

Click to download the PDB-style file with coordinates for d1gaga_.
(The format of our PDB-style files is described here.)

Timeline for d1gaga_: