SCOP 1.73: Domain d1gaga_: 1gag A:

Lineage for d1gaga_ (1gag A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Insulin receptor [56162] (1 species)
   PTK group; InsR subfamily; membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [56163] (8 PDB entries)

8. Domain d1gaga_: 1gag A: [41704]
   complexed with 112, mg; mutant

Details for d1gaga_

PDB Entry: 1gag, 2.7 Å

PDB Description: crystal structure of the insulin receptor kinase in complex with a bisubstrate inhibitor

PDB Compounds: (A:) insulin receptor, tyrosine kinase domain

SCOP Domain Sequences for d1gaga_:

Sequence; same for both SEQRES and ATOM records:

>d1gaga_ d.144.1.7 (A:) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}
ssvfvpdewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesaslre
rieflneasvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaennpg
rppptlqemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdiyet
dyyrkggkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneqvlk
fvmdggyldqpdncpervtdlmrmcwqfnpkmrptfleivnllkddlhpsfpevsffhse
enk

Timeline for d1gaga_:

• d1gaga_ first appeared (with stable ids) in SCOP 1.55
  
• d1gaga_ appears in SCOP 1.71
  
• d1gaga_ appears in SCOP 1.75
  
• d1gaga_ appears in the current release, SCOPe 2.08