![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (47 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein Insulin receptor [56162] (1 species) PTK group; InsR subfamily; membrane spanning protein tyrosine kinase |
![]() | Species Human (Homo sapiens) [TaxId:9606] [56163] (6 PDB entries) |
![]() | Domain d1gaga_: 1gag A: [41704] complexed with 112, mg; mutant |
PDB Entry: 1gag (more details), 2.7 Å
SCOP Domain Sequences for d1gaga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gaga_ d.144.1.7 (A:) Insulin receptor {Human (Homo sapiens)} ssvfvpdewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesaslre rieflneasvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaennpg rppptlqemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdiyet dyyrkggkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneqvlk fvmdggyldqpdncpervtdlmrmcwqfnpkmrptfleivnllkddlhpsfpevsffhse enk
Timeline for d1gaga_: