Lineage for d1gaga_ (1gag A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (4 families) 
Family d.144.1.2: Tyrosine kinase [56150] (8 proteins) 
Protein Insulin receptor [56162] (1 species) Species Human (Homo sapiens) [TaxId:9606] [56163] (3 PDB entries) 
Domain d1gaga_: 1gag A: [41704]
Details for d1gaga_
PDB Entry: 1gag (more details), 2.7 Å
PDB Description: crystal structure of the insulin receptor kinase in complex with a bisubstrate inhibitor
SCOP Domain Sequences for d1gaga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gaga_ d.144.1.2 (A:) Insulin receptor {Human (Homo sapiens)}
ssvfvpdewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesaslre
rieflneasvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaennpg
rppptlqemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdiyet
dyyrkggkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneqvlk
fvmdggyldqpdncpervtdlmrmcwqfnpkmrptfleivnllkddlhpsfpevsffhse
enk
SCOP Domain Coordinates for d1gaga_:
Click to download the PDB-style file with coordinates for d1gaga_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gaga_:
- d1gaga_ appears in SCOP 1.57
- d1gaga_ appears in the current release, SCOPe 2.08
View in 3D