Lineage for d2fgia_ (2fgi A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1433536Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1433537Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1433619Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1434615Protein Fibroblast growth factor receptor 1 [56158] (1 species)
    PTK group; FGFR subfamily; membrane spanning protein tyrosine kinase
  7. 1434616Species Human (Homo sapiens) [TaxId:9606] [56159] (14 PDB entries)
  8. 1434633Domain d2fgia_: 2fgi A: [41699]
    complexed with pd1

Details for d2fgia_

PDB Entry: 2fgi (more details), 2.5 Å

PDB Description: crystal structure of the tyrosine kinase domain of fgf receptor 1 in complex with inhibitor pd173074
PDB Compounds: (A:) protein (fibroblast growth factor (fgf) receptor 1)

SCOPe Domain Sequences for d2fgia_:

Sequence, based on SEQRES records: (download)

>d2fgia_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]}
elpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlksdatek
dlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppgley
synpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfg
lardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggspypg
vpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrivalts

Sequence, based on observed residues (ATOM records): (download)

>d2fgia_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]}
elpedprwelprdrlvlgkplgqvvlaeaiglpnrvtkvavkmlksdatekdlsdlisem
emmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppqlsskdlvscayq
vargmeylaskkcihrdlaarnvlvtednvmkiadfgladihhidyykktngrlpvkwma
pealfdriythqsdvwsfgvllweiftlggspypgvpveelfkllkeghrmdkpsnctne
lymmmrdcwhavpsqrptfkqlvedldrivalts

SCOPe Domain Coordinates for d2fgia_:

Click to download the PDB-style file with coordinates for d2fgia_.
(The format of our PDB-style files is described here.)

Timeline for d2fgia_: