Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Fibroblast growth factor receptor 1 [56158] (1 species) PTK group; FGFR subfamily; membrane spanning protein tyrosine kinase |
Species Human (Homo sapiens) [TaxId:9606] [56159] (32 PDB entries) |
Domain d1fgib_: 1fgi B: [41698] complexed with su1 |
PDB Entry: 1fgi (more details), 2.5 Å
SCOPe Domain Sequences for d1fgib_:
Sequence, based on SEQRES records: (download)
>d1fgib_ d.144.1.7 (B:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} seyelpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlksda tekdlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppg leysynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkia dfglardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggsp ypgvpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrival t
>d1fgib_ d.144.1.7 (B:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} seyelpedprwelprdrlvlgkplgegafgqvvlaeaiglpnrvtkvavkmlksdatekd lsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrqlsskdl vscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfgladyykkgrlpvkwmap ealfdriythqsdvwsfgvllweiftlggspypgvpveelfkllkeghrmdkpsnctnel ymmmrdcwhavpsqrptfkqlvedldrivalt
Timeline for d1fgib_: