SCOP 1.73: Domain d2srca3: 2src A:249-533

Lineage for d2srca3 (2src A:249-533)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein c-src tyrosine kinase [56155] (2 species)
   PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [56156] (6 PDB entries)

8. Domain d2srca3: 2src A:249-533 [41691]
   Other proteins in same PDB: d2srca1, d2srca2
   complexed with anp

Details for d2srca3

PDB Entry: 2src, 1.5 Å

PDB Description: crystal structure of human tyrosine-protein kinase c-src, in complex with amp-pnp

PDB Compounds: (A:) tyrosine-protein kinase src

SCOP Domain Sequences for d2srca3:

Sequence; same for both SEQRES and ATOM records:

>d2srca3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
kpqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeafl
qeaqvmkklrheklvqlyavvseepiyivteymskgslldflkgetgkylrlpqlvdmaa
qiasgmayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikw
tapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecp
eslhdlmcqcwrkepeerptfeylqafledyftstepqyqpgenl

Timeline for d2srca3:

• d2srca3 first appeared (with stable ids) in SCOP 1.55, called d2src_3
  
• d2srca3 was called d2src_3 in SCOP 1.71
  
• d2srca3 appears in SCOP 1.75
  
• d2srca3 appears in the current release, SCOPe 2.08