Lineage for d2src_3 (2src 249-533)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 84393Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 84394Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
  5. 84533Family d.144.1.2: Tyrosine kinase [56150] (9 proteins)
  6. 84540Protein c-src tyrosine kinase [56155] (2 species)
  7. 84543Species Human (Homo sapiens) [TaxId:9606] [56156] (2 PDB entries)
  8. 84545Domain d2src_3: 2src 249-533 [41691]
    Other proteins in same PDB: d2src_1, d2src_2

Details for d2src_3

PDB Entry: 2src (more details), 1.5 Å

PDB Description: crystal structure of human tyrosine-protein kinase c-src, in complex with amp-pnp

SCOP Domain Sequences for d2src_3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2src_3 d.144.1.2 (249-533) c-src tyrosine kinase {Human (Homo sapiens)}
kpqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeafl
qeaqvmkklrheklvqlyavvseepiyivteymskgslldflkgetgkylrlpqlvdmaa
qiasgmayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikw
tapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecp
eslhdlmcqcwrkepeerptfeylqafledyftstepqyqpgenl

SCOP Domain Coordinates for d2src_3:

Click to download the PDB-style file with coordinates for d2src_3.
(The format of our PDB-style files is described here.)

Timeline for d2src_3: