SCOP 1.59: Domain d1qpja_: 1qpj A:

Lineage for d1qpja_ (1qpj A:)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families)

5. Family d.144.1.2: Tyrosine kinase [56150] (11 proteins)

6. Protein Lymphocyte kinase (lck) [56153] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56154] (5 PDB entries)

8. Domain d1qpja_: 1qpj A: [41689]

Details for d1qpja_

PDB Entry: 1qpj, 2.2 Å

PDB Description: crystal structure of the lymphocyte-specific kinase lck in complex with staurosporine.

SCOP Domain Sequences for d1qpja_:

Sequence; same for both SEQRES and ATOM records:

>d1qpja_ d.144.1.2 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens)}
dewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflaeanlmkql
qhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiaegmafi
eernyihrdlraanilvsdtlsckiadfglarliedneytaregakfpikwtapeainyg
tftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdncpeelyqlmrl
cwkerpedrptfdylrsvledfftat

Timeline for d1qpja_:

• d1qpja_ first appeared (with stable ids) in SCOP 1.55
  
• d1qpja_ appears in SCOP 1.57
  
• d1qpja_ appears in SCOP 1.61
  
• d1qpja_ appears in the current release, SCOPe 2.08