Lineage for d1qpea_ (1qpe A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 138043Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 138044Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
  5. 138202Family d.144.1.2: Tyrosine kinase [56150] (11 proteins)
  6. 138249Protein Lymphocyte kinase (lck) [56153] (1 species)
  7. 138250Species Human (Homo sapiens) [TaxId:9606] [56154] (5 PDB entries)
  8. 138253Domain d1qpea_: 1qpe A: [41688]

Details for d1qpea_

PDB Entry: 1qpe (more details), 2 Å

PDB Description: structural analysis of the lymphocyte-specific kinase lck in complex with non-selective and src family selective kinase inhibitors

SCOP Domain Sequences for d1qpea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qpea_ d.144.1.2 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens)}
kpwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflaean
lmkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiae
gmafieernyihrdlraanilvsdtlsckiadfglarliedneytaregakfpikwtape
ainygtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdncpeely
qlmrlcwkerpedrptfdylrsvledfftat

SCOP Domain Coordinates for d1qpea_:

Click to download the PDB-style file with coordinates for d1qpea_.
(The format of our PDB-style files is described here.)

Timeline for d1qpea_: