Lineage for d1qpda_ (1qpd A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2586210Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2588329Protein Lymphocyte kinase (lck) [56153] (1 species)
    PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase
  7. 2588330Species Human (Homo sapiens) [TaxId:9606] [56154] (34 PDB entries)
  8. 2588337Domain d1qpda_: 1qpd A: [41687]
    complexed with so4, stu

Details for d1qpda_

PDB Entry: 1qpd (more details), 2 Å

PDB Description: structural analysis of the lymphocyte-specific kinase lck in complex with non-selective and src family selective kinase inhibitors
PDB Compounds: (A:) lck kinase

SCOPe Domain Sequences for d1qpda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qpda_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]}
kpwwedawevpretlklverlgagqagevwmgyynghtkvavkslkqgsmspdaflaean
lmkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiae
gmafieernyihrdlraanilvsdtlsckiadfglarliedaeytaregakfpikwtape
ainygtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdncpeely
qlmrlcwkerpedrptfdylrsvledfftate

SCOPe Domain Coordinates for d1qpda_:

Click to download the PDB-style file with coordinates for d1qpda_.
(The format of our PDB-style files is described here.)

Timeline for d1qpda_: