SCOPe 2.01: Domain d1qpda_: 1qpd A:

Lineage for d1qpda_ (1qpd A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Lymphocyte kinase (lck) [56153] (1 species)
   PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [56154] (33 PDB entries)

8. Domain d1qpda_: 1qpd A: [41687]
   complexed with so4, stu

Details for d1qpda_

PDB Entry: 1qpd, 2 Å

PDB Description: structural analysis of the lymphocyte-specific kinase lck in complex with non-selective and src family selective kinase inhibitors

PDB Compounds: (A:) lck kinase

SCOPe Domain Sequences for d1qpda_:

Sequence; same for both SEQRES and ATOM records:

>d1qpda_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]}
kpwwedawevpretlklverlgagqagevwmgyynghtkvavkslkqgsmspdaflaean
lmkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiae
gmafieernyihrdlraanilvsdtlsckiadfglarliedaeytaregakfpikwtape
ainygtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdncpeely
qlmrlcwkerpedrptfdylrsvledfftate

Timeline for d1qpda_:

• d1qpda_ first appeared (with stable ids) in SCOP 1.55
  
• d1qpda_ appears in SCOP 1.75
  
• d1qpda_ appears in SCOPe 2.02
  
• d1qpda_ appears in the current release, SCOPe 2.08