![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (4 families) ![]() |
![]() | Family d.144.1.2: Tyrosine kinase [56150] (8 proteins) |
![]() | Protein Lymphocyte kinase (lck) [56153] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [56154] (5 PDB entries) |
![]() | Domain d3lck__: 3lck - [41686] |
PDB Entry: 3lck (more details), 1.7 Å
SCOP Domain Sequences for d3lck__:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lck__ d.144.1.2 (-) Lymphocyte kinase (lck) {Human (Homo sapiens)} kpwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflaean lmkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiae gmafieernyihrdlraanilvsdtlsckiadfglarliedneytaregakfpikwtape ainygtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdncpeely qlmrlcwkerpedrptfdylrsvledfftat
Timeline for d3lck__: