Lineage for d3lck__ (3lck -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (4 families) 
Family d.144.1.2: Tyrosine kinase [56150] (8 proteins) 
Protein Lymphocyte kinase (lck) [56153] (1 species) Species Human (Homo sapiens) [TaxId:9606] [56154] (5 PDB entries) 
Domain d3lck__: 3lck - [41686]
Details for d3lck__
PDB Entry: 3lck (more details), 1.7 Å
PDB Description: the kinase domain of human lymphocyte kinase (lck), activated form (auto-phosphorylated on tyr394)
SCOP Domain Sequences for d3lck__:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lck__ d.144.1.2 (-) Lymphocyte kinase (lck) {Human (Homo sapiens)}
kpwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflaean
lmkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiae
gmafieernyihrdlraanilvsdtlsckiadfglarliedneytaregakfpikwtape
ainygtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdncpeely
qlmrlcwkerpedrptfdylrsvledfftat
SCOP Domain Coordinates for d3lck__:
Click to download the PDB-style file with coordinates for d3lck__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3lck__:
- d3lck__ appears in SCOP 1.57
- d3lck__ appears in the current release, SCOPe 2.08, called d3lcka_
View in 3D