Lineage for d1qpca_ (1qpc A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (4 families) 
Family d.144.1.2: Tyrosine kinase [56150] (8 proteins) 
Protein Lymphocyte kinase (lck) [56153] (1 species) Species Human (Homo sapiens) [TaxId:9606] [56154] (5 PDB entries) 
Domain d1qpca_: 1qpc A: [41685]
Details for d1qpca_
PDB Entry: 1qpc (more details), 1.6 Å
PDB Description: structural analysis of the lymphocyte-specific kinase lck in complex with non-selective and src family selective kinase inhibitors
SCOP Domain Sequences for d1qpca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qpca_ d.144.1.2 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens)}
kpwwedewevpretlklverlgagqfgevwmgyynghtkvavkslkqgsmspdaflaean
lmkqlqhqrlvrlyavvtqepiyiiteymengslvdflktpsgikltinklldmaaqiae
gmafieernyihrdlraanilvsdtlsckiadfglarliedneytaregakfpikwtape
ainygtftiksdvwsfgillteivthgripypgmtnpeviqnlergyrmvrpdncpeely
qlmrlcwkerpedrptfdylrsvledfftate
SCOP Domain Coordinates for d1qpca_:
Click to download the PDB-style file with coordinates for d1qpca_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qpca_:
- d1qpca_ appears in SCOP 1.57
- d1qpca_ appears in the current release, SCOPe 2.08
View in 3D