SCOPe 2.05: Domain d2hckb3: 2hck B:249-531

Lineage for d2hckb3 (2hck B:249-531)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Haemopoetic cell kinase Hck [56151] (1 species)
   PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [56152] (19 PDB entries)

8. Domain d2hckb3: 2hck B:249-531 [41684]
   Other proteins in same PDB: d2hcka1, d2hcka2, d2hckb1, d2hckb2
   SH2 domain- and SH3 domain-binding regulatory tails are included
   complexed with ca, que

Details for d2hckb3

PDB Entry: 2hck, 3 Å

PDB Description: src family kinase hck-quercetin complex

PDB Compounds: (B:) hematopoetic cell kinase hck

SCOPe Domain Sequences for d2hckb3:

Sequence; same for both SEQRES and ATOM records:

>d2hckb3 d.144.1.7 (B:249-531) Haemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
kpqkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveafla
eanvmktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaq
iaegmafieqrnyihrdlraanilvsaslvckiadfglarvgakfpikwtapeainfgsf
tiksdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpeelynimmrcw
knrpeerptfeyiqsvlddfytatesqyqqqp

Timeline for d2hckb3:

• d2hckb3 first appeared (with stable ids) in SCOP 1.55
  
• d2hckb3 appears in SCOPe 2.04
  
• d2hckb3 appears in SCOPe 2.06
  
• d2hckb3 appears in the current release, SCOPe 2.08