Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) |
Family d.144.1.2: Tyrosine kinase [56150] (9 proteins) |
Protein Haemopoetic cell kinase Hck [56151] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [56152] (3 PDB entries) |
Domain d2hckb3: 2hck B:249-531 [41684] Other proteins in same PDB: d2hcka1, d2hcka2, d2hckb1, d2hckb2 |
PDB Entry: 2hck (more details), 3 Å
SCOP Domain Sequences for d2hckb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hckb3 d.144.1.2 (B:249-531) Haemopoetic cell kinase Hck {Human (Homo sapiens)} kpqkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveafla eanvmktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaq iaegmafieqrnyihrdlraanilvsaslvckiadfglarvgakfpikwtapeainfgsf tiksdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpeelynimmrcw knrpeerptfeyiqsvlddfytatesqyqqqp
Timeline for d2hckb3: