Lineage for d6t62b_ (6t62 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842913Protein automated matches [190085] (59 species)
    not a true protein
  7. 2842914Species Acinetobacter baumannii [TaxId:470] [272807] (7 PDB entries)
  8. 2842923Domain d6t62b_: 6t62 B: [416834]
    automated match to d6wpra_
    complexed with nap

Details for d6t62b_

PDB Entry: 6t62 (more details), 1.8 Å

PDB Description: crystal structure of acinetobacter baumannii fabg in complex with nadph at 1.8 a resolution
PDB Compounds: (B:) 3-oxoacyl-(acyl-carrier-protein) reductase

SCOPe Domain Sequences for d6t62b_:

Sequence, based on SEQRES records: (download)

>d6t62b_ c.2.1.2 (B:) automated matches {Acinetobacter baumannii [TaxId: 470]}
erkvalvtgasrgigaaiaqqliqdgyfvvgtatsesgaqkltdsfgeqgaglaldvrnl
deieavvshieqnygpvlvlvnnagitkdnlllrmseddwddilnihlkavyrlskrvlk
gmtkarfgriinissvvahfanpgqanysaakagieafsrslakemgsrqitvnsvapgf
iatemtdalsedirkkmsdqvalnrlgepqdianavsflasdkagyitgtvlhvngglym
a

Sequence, based on observed residues (ATOM records): (download)

>d6t62b_ c.2.1.2 (B:) automated matches {Acinetobacter baumannii [TaxId: 470]}
erkvalvtgasrgigaaiaqqliqdgyfvvgtatsesgaqkltdsfgeqgaglaldvrnl
deieavvshieqnygpvlvlvnnagitkdnlllrmseddwddilnihlkavyrlskrvlk
gmtkarfgriinissvvahfanpgqanysaakagieafsrslakemgsrqitvnsvapgf
iatkkmsdqvalnrlgepqdianavsflasdkagyitgtvlhvngglyma

SCOPe Domain Coordinates for d6t62b_:

Click to download the PDB-style file with coordinates for d6t62b_.
(The format of our PDB-style files is described here.)

Timeline for d6t62b_:

  • d6t62b_ is new in SCOPe 2.08-stable