SCOP 1.55: Domain d1ad5b3: 1ad5 B:249-531

Lineage for d1ad5b3 (1ad5 B:249-531)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (4 families)

5. Family d.144.1.2: Tyrosine kinase [56150] (8 proteins)

6. Protein Haemopoetic cell kinase Hck [56151] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56152] (3 PDB entries)

8. Domain d1ad5b3: 1ad5 B:249-531 [41682]
   Other proteins in same PDB: d1ad5a1, d1ad5a2, d1ad5b1, d1ad5b2

Details for d1ad5b3

PDB Entry: 1ad5, 2.6 Å

PDB Description: src family kinase hck-amp-pnp complex

SCOP Domain Sequences for d1ad5b3:

Sequence; same for both SEQRES and ATOM records:

>d1ad5b3 d.144.1.2 (B:249-531) Haemopoetic cell kinase Hck {Human (Homo sapiens)}
kpqkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveafla
eanvmktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaq
iaegmafieqrnyihrdlraanilvsaslvckiadfglarvgakfpikwtapeainfgsf
tiksdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpeelynimmrcw
knrpeerptfeyiqsvlddfytatesqyqqqp

Timeline for d1ad5b3:

• d1ad5b3 appears in SCOP 1.57
  
• d1ad5b3 appears in the current release, SCOPe 2.08