SCOPe 2.05: Domain d1ad5a3: 1ad5 A:249-531

Lineage for d1ad5a3 (1ad5 A:249-531)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Haemopoetic cell kinase Hck [56151] (1 species)
   PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [56152] (19 PDB entries)

8. Domain d1ad5a3: 1ad5 A:249-531 [41681]
   Other proteins in same PDB: d1ad5a1, d1ad5a2, d1ad5b1, d1ad5b2
   complexed with anp, ca

Details for d1ad5a3

PDB Entry: 1ad5, 2.6 Å

PDB Description: src family kinase hck-amp-pnp complex

PDB Compounds: (A:) haematopoetic cell kinase hck

SCOPe Domain Sequences for d1ad5a3:

Sequence; same for both SEQRES and ATOM records:

>d1ad5a3 d.144.1.7 (A:249-531) Haemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
kpqkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveafla
eanvmktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaq
iaegmafieqrnyihrdlraanilvsaslvckiadfglarvgakfpikwtapeainfgsf
tiksdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpeelynimmrcw
knrpeerptfeyiqsvlddfytatesqyqqqp

Timeline for d1ad5a3:

• d1ad5a3 first appeared (with stable ids) in SCOP 1.55
  
• d1ad5a3 appears in SCOPe 2.04
  
• d1ad5a3 appears in SCOPe 2.06
  
• d1ad5a3 appears in the current release, SCOPe 2.08