Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Sky1p [56148] (1 species) CMGC group; Clk subfamily; serine/threonine kinase |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56149] (5 PDB entries) |
Domain d1howa_: 1how A: [41679] residues 305-538 were deleted and replaced with Val-Asp complexed with edo, so4 |
PDB Entry: 1how (more details), 2.1 Å
SCOPe Domain Sequences for d1howa_:
Sequence, based on SEQRES records: (download)
>d1howa_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} fhpafkgepykdaryilvrklgwghfstvwlakdmvnnthvamkivrgdkvyteaaedei kllqrvndadntkedsmganhilklldhfnhkgpngvhvvmvfevlgenllalikkyehr gipliyvkqiskqlllgldymhrrcgiihtdikpenvlmeivdspenliqikiadlgnac wydehytnsiqtreyrspevllgapwgcgadiwstaclifelitgdflfepdeghsytkd ddhiaqiiellgelpsyllrngkytrtffnsrgllrnisklkfwpledvltekykfskde akeisdflspmlqldprkradagglvnhpwlkdtlgmeeirvpdrelygsgsdipgwfee vr
>d1howa_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} fhpafkgepykdaryilvrklgwghfstvwlakdmvnnthvamkivrgdkvyteaaedei kllqrvndadntkedsmganhilklldhfnhkgpngvhvvmvfevlgenllalikkyehr gipliyvkqiskqlllgldymhrrcgiihtdikpenvlmeivdspenliqikiadlgnac wydehytnsiqtreyrspevllgapwgcgadiwstaclifelitgdflfepddddhiaqi iellgelpsyllrngkytrtffsklkfwpledvltekykfskdeakeisdflspmlqldp rkradagglvnhpwlkdtlgmeeirvpdrelygsgsdipgwfeevr
Timeline for d1howa_: