SCOP 1.71: Domain d1ds5d_: 1ds5 D:

Lineage for d1ds5d_ (1ds5 D:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (60 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Protein kinase CK2, alpha subunit [56142] (2 species)
   CMGC group; CK2 subfamily; serine/threonine kinase

7. Species Maize (Zea mays) [TaxId:4577] [56143] (13 PDB entries)

8. Domain d1ds5d_: 1ds5 D: [41672]
   complexed with amp, mo3

Details for d1ds5d_

PDB Entry: 1ds5, 3.16 Å

PDB Description: dimeric crystal structure of the alpha subunit in complex with two beta peptides mimicking the architecture of the tetrameric protein kinase ck2 holoenzyme.

SCOP Domain Sequences for d1ds5d_:

Sequence; same for both SEQRES and ATOM records:

>d1ds5d_ d.144.1.7 (D:) Protein kinase CK2, alpha subunit {Maize (Zea mays)}
mskarvyadvnvlrpkeywdyealtvqwgeqddyevvrkvgrgkysevfeginvnnnekc
iikilkpvkkkkikreikilqnlcggpnivklldivrdqhsktpslifeyvnntdfkvly
ptltdydiryyiyellkaldychsqgimhrdvkphnvmidhelrklrlidwglaefyhpg
keynvrvasryfkgpellvdlqdydysldmwslgcmfagmifrkepffyghdnhdqlvki
akvlgtdglnvylnkyrieldpqlealvgrhsrkpwlkfmnadnqhlvspeaidfldkll
rydhqerltaleamthpyfqqvraaens

Timeline for d1ds5d_:

• d1ds5d_ first appeared (with stable ids) in SCOP 1.55
  
• d1ds5d_ appears in SCOP 1.69
  
• d1ds5d_ appears in SCOP 1.73
  
• d1ds5d_ appears in the current release, SCOPe 2.08