Lineage for d1ds5d_ (1ds5 D:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. Protein Protein kinase CK2, alpha subunit [56142] (3 species)
    CMGC group; CK2 subfamily; serine/threonine kinase
  7. Species Maize (Zea mays) [TaxId:4577] [56143] (33 PDB entries)
  8. Domain d1ds5d_: 1ds5 D: [41672]
    complexed with amp, mg

Details for d1ds5d_

PDB Entry: 1ds5 (more details), 3.16 Å

PDB Description: dimeric crystal structure of the alpha subunit in complex with two beta peptides mimicking the architecture of the tetrameric protein kinase ck2 holoenzyme.
PDB Compounds: (D:) casein kinase, alpha chain

SCOPe Domain Sequences for d1ds5d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ds5d_ d.144.1.7 (D:) Protein kinase CK2, alpha subunit {Maize (Zea mays) [TaxId: 4577]}
mskarvyadvnvlrpkeywdyealtvqwgeqddyevvrkvgrgkysevfeginvnnnekc
iikilkpvkkkkikreikilqnlcggpnivklldivrdqhsktpslifeyvnntdfkvly
ptltdydiryyiyellkaldychsqgimhrdvkphnvmidhelrklrlidwglaefyhpg
keynvrvasryfkgpellvdlqdydysldmwslgcmfagmifrkepffyghdnhdqlvki
akvlgtdglnvylnkyrieldpqlealvgrhsrkpwlkfmnadnqhlvspeaidfldkll
rydhqerltaleamthpyfqqvraaens

SCOPe Domain Coordinates for d1ds5d_ are not available.

Timeline for d1ds5d_:

Domains from other chains:
(mouse over for more information)
d1ds5a_, d1ds5b_, d1ds5c_