SCOPe 2.08: Domain d1daya_: 1day A:

Lineage for d1daya_ (1day A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Protein kinase CK2, alpha subunit [56142] (3 species)
   CMGC group; CK2 subfamily; serine/threonine kinase

7. Species Maize (Zea mays) [TaxId:4577] [56143] (33 PDB entries)

8. Domain d1daya_: 1day A: [41667]
   complexed with gnp, mg

Details for d1daya_

PDB Entry: 1day, 2.2 Å

PDB Description: crystal structure of a binary complex of protein kinase ck2 (alpha-subunit) and mg-gmppnp

PDB Compounds: (A:) protein kinase ck2

SCOPe Domain Sequences for d1daya_:

Sequence; same for both SEQRES and ATOM records:

>d1daya_ d.144.1.7 (A:) Protein kinase CK2, alpha subunit {Maize (Zea mays) [TaxId: 4577]}
skarvyadvnvlrpkeywdyealtvqwgeqddyevvrkvgrgkysevfeginvnnnekci
ikilkpvkkkkikreikilqnlcggpnivklldivrdqhsktpslifeyvnntdfkvlyp
tltdydiryyiyellkaldychsqgimhrdvkphnvmidhelrklrlidwglaefyhpgk
eynvrvasryfkgpellvdlqdydysldmwslgcmfagmifrkepffyghdnhdqlvkia
kvlgtdglnvylnkyrieldpqlealvgrhsrkpwlkfmnadnqhlvspeaidfldkllr
ydhqerltaleamthpyfqqvraaens

Timeline for d1daya_:

• d1daya_ first appeared (with stable ids) in SCOP 1.55
  
• d1daya_ appears in SCOPe 2.07