Lineage for d2csn__ (2csn -)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 138043Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 138044Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
  5. 138045Family d.144.1.1: Serine/threonin kinases [56113] (17 proteins)
  6. 138074Protein Casein kinase-1, CK1 [56139] (2 species)
  7. 138075Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [56141] (3 PDB entries)
  8. 138077Domain d2csn__: 2csn - [41665]

Details for d2csn__

PDB Entry: 2csn (more details), 2.5 Å

PDB Description: binary complex of casein kinase-1 with cki7

SCOP Domain Sequences for d2csn__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2csn__ d.144.1.1 (-) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe)}
nvvgvhykvgrrigegsfgvifegtnllnnqqvaikfeprrsdapqlrdeyrtykllagc
tgipnvyyfgqeglhnvlvidllgpsledlldlcgrkfsvktvamaakqmlarvqsihek
slvyrdikpdnfligrpnsknanmiyvvdfgmvkfyrdpvtkqhipyrekknlsgtarym
sinthlgreqsrrddlealghvfmyflrgslpwqglkaatnkqkyerigekkqstplrel
cagfpeefykymhyarnlafdatpdydylqglfskvlerlnttedenfdwnll

SCOP Domain Coordinates for d2csn__:

Click to download the PDB-style file with coordinates for d2csn__.
(The format of our PDB-style files is described here.)

Timeline for d2csn__: