Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) many known members contain KOW motif |
Family b.34.5.0: automated matches [227245] (1 protein) not a true family |
Protein automated matches [227015] (11 species) not a true protein |
Species Corynebacterium glutamicum [TaxId:1718] [420051] (1 PDB entry) |
Domain d6s8za1: 6s8z A:2-63 [416641] Other proteins in same PDB: d6s8za2, d6s8za3 automated match to d6rk3a1 complexed with act, edo, na |
PDB Entry: 6s8z (more details), 2.2 Å
SCOPe Domain Sequences for d6s8za1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6s8za1 b.34.5.0 (A:2-63) automated matches {Corynebacterium glutamicum [TaxId: 1718]} attadfknglvlknegklqqiiefqhvkpgkgpafvrtklkdvvtgktidktwnagvkve ta
Timeline for d6s8za1: