Lineage for d6s8za1 (6s8z A:2-63)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2783937Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) (S)
    many known members contain KOW motif
  5. 2784245Family b.34.5.0: automated matches [227245] (1 protein)
    not a true family
  6. 2784246Protein automated matches [227015] (11 species)
    not a true protein
  7. 2784250Species Corynebacterium glutamicum [TaxId:1718] [420051] (1 PDB entry)
  8. 2784251Domain d6s8za1: 6s8z A:2-63 [416641]
    Other proteins in same PDB: d6s8za2, d6s8za3
    automated match to d6rk3a1
    complexed with act, edo, na

Details for d6s8za1

PDB Entry: 6s8z (more details), 2.2 Å

PDB Description: elongation factor p from corynebacterium glutamicum
PDB Compounds: (A:) elongation factor P

SCOPe Domain Sequences for d6s8za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6s8za1 b.34.5.0 (A:2-63) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
attadfknglvlknegklqqiiefqhvkpgkgpafvrtklkdvvtgktidktwnagvkve
ta

SCOPe Domain Coordinates for d6s8za1:

Click to download the PDB-style file with coordinates for d6s8za1.
(The format of our PDB-style files is described here.)

Timeline for d6s8za1:

  • d6s8za1 is new in SCOPe 2.08-stable