Lineage for d1csn__ (1csn -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (4 families) 
Family d.144.1.1: Serine/threonin kinases [56113] (15 proteins) 
Protein Casein kinase-1, CK1 [56139] (2 species) Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [56141] (2 PDB entries) 
Domain d1csn__: 1csn - [41664]
Details for d1csn__
PDB Entry: 1csn (more details), 2 Å
PDB Description: binary complex of casein kinase-1 with mgatp
SCOP Domain Sequences for d1csn__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1csn__ d.144.1.1 (-) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe)}
nvvgvhykvgrrigegsfgvifegtnllnnqqvaikfeprrsdapqlrdeyrtykllagc
tgipnvyyfgqeglhnvlvidllgpsledlldlcgrkfsvktvamaakqmlarvqsihek
slvyrdikpdnfligrpnsknanmiyvvdfgmvkfyrdpvtkqhipyrekknlsgtarym
sinthlgreqsrrddlealghvfmyflrgslpwqglkaatnkqkyerigekkqstplrel
cagfpeefykymhyarnlafdatpdydylqglfskvlerlnttedenfdwnll
SCOP Domain Coordinates for d1csn__:
Click to download the PDB-style file with coordinates for d1csn__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1csn__:
- d1csn__ appears in SCOP 1.57
- d1csn__ appears in the current release, SCOPe 2.08, called d1csna_
View in 3D