SCOP 1.73: Domain d1ckjb_: 1ckj B:

Lineage for d1ckjb_ (1ckj B:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Casein kinase-1, CK1 [56139] (2 species)
   OPK group; CKI subfamily; serine/threonine kinase

7. Species Rat (Rattus norvegicus) [TaxId:10116] [56140] (2 PDB entries)

8. Domain d1ckjb_: 1ckj B: [41663]
   complexed with wo4; mutant

Details for d1ckjb_

PDB Entry: 1ckj, 2.46 Å

PDB Description: casein kinase i delta truncation mutant containing residues 1-317 complex with bound tungstate

PDB Compounds: (B:) recombinant casein kinase I delta

SCOP Domain Sequences for d1ckjb_:

Sequence; same for both SEQRES and ATOM records:

>d1ckjb_ d.144.1.7 (B:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]}
melrvgnryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmq
ggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyih
sknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtarya
sinthlgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievl
ckgypsefatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnml

Timeline for d1ckjb_:

• d1ckjb_ first appeared (with stable ids) in SCOP 1.55
  
• d1ckjb_ appears in SCOP 1.71
  
• d1ckjb_ appears in SCOP 1.75
  
• d1ckjb_ appears in the current release, SCOPe 2.08