Lineage for d1ckjb_ (1ckj B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2980262Protein Casein kinase-1, CK1 [56139] (4 species)
    OPK group; CKI subfamily; serine/threonine kinase
  7. 2980334Species Norway rat (Rattus norvegicus) [TaxId:10116] [56140] (2 PDB entries)
  8. 2980338Domain d1ckjb_: 1ckj B: [41663]
    complexed with wo4; mutant

Details for d1ckjb_

PDB Entry: 1ckj (more details), 2.46 Å

PDB Description: casein kinase i delta truncation mutant containing residues 1-317 complex with bound tungstate
PDB Compounds: (B:) recombinant casein kinase I delta

SCOPe Domain Sequences for d1ckjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ckjb_ d.144.1.7 (B:) Casein kinase-1, CK1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
melrvgnryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmq
ggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyih
sknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtarya
sinthlgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievl
ckgypsefatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnml

SCOPe Domain Coordinates for d1ckjb_:

Click to download the PDB-style file with coordinates for d1ckjb_.
(The format of our PDB-style files is described here.)

Timeline for d1ckjb_: