![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein Casein kinase-1, CK1 [56139] (2 species) OPK group; CKI subfamily; serine/threonine kinase |
![]() | Species Rat (Rattus norvegicus) [TaxId:10116] [56140] (2 PDB entries) |
![]() | Domain d1ckja_: 1ckj A: [41662] |
PDB Entry: 1ckj (more details), 2.46 Å
SCOP Domain Sequences for d1ckja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ckja_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} melrvgnryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmq ggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyih sknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtarya sinthlgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievl ckgypsefatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlkfg
Timeline for d1ckja_: