Lineage for d1ckja_ (1ckj A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734668Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 734669Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 734710Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 734870Protein Casein kinase-1, CK1 [56139] (2 species)
    OPK group; CKI subfamily; serine/threonine kinase
  7. 734876Species Rat (Rattus norvegicus) [TaxId:10116] [56140] (2 PDB entries)
  8. 734879Domain d1ckja_: 1ckj A: [41662]

Details for d1ckja_

PDB Entry: 1ckj (more details), 2.46 Å

PDB Description: casein kinase i delta truncation mutant containing residues 1-317 complex with bound tungstate
PDB Compounds: (A:) recombinant casein kinase I delta

SCOP Domain Sequences for d1ckja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ckja_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]}
melrvgnryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmq
ggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyih
sknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtarya
sinthlgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievl
ckgypsefatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlkfg

SCOP Domain Coordinates for d1ckja_:

Click to download the PDB-style file with coordinates for d1ckja_.
(The format of our PDB-style files is described here.)

Timeline for d1ckja_: