Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) consists only of helices |
Family a.4.1.0: automated matches [191447] (1 protein) not a true family |
Protein automated matches [190674] (25 species) not a true protein |
Species Acinetobacter baumannii [TaxId:509173] [389356] (2 PDB entries) |
Domain d6rx9a1: 6rx9 A:3-67 [416580] Other proteins in same PDB: d6rx9a2, d6rx9b2 automated match to d6rxba1 complexed with so4 |
PDB Entry: 6rx9 (more details), 1.8 Å
SCOPe Domain Sequences for d6rx9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6rx9a1 a.4.1.0 (A:3-67) automated matches {Acinetobacter baumannii [TaxId: 509173]} kldkgtviaaalellnevgmdslttrklaerlkvqqpalywhfqnkralldalaeamlae rhtrs
Timeline for d6rx9a1: