Lineage for d6rx9a1 (6rx9 A:3-67)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692712Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 2692713Protein automated matches [190674] (25 species)
    not a true protein
  7. 2692714Species Acinetobacter baumannii [TaxId:509173] [389356] (2 PDB entries)
  8. 2692715Domain d6rx9a1: 6rx9 A:3-67 [416580]
    Other proteins in same PDB: d6rx9a2, d6rx9b2
    automated match to d6rxba1
    complexed with so4

Details for d6rx9a1

PDB Entry: 6rx9 (more details), 1.8 Å

PDB Description: crystal structure of tetr from acinetobacter baumannii aye
PDB Compounds: (A:) Tetracycline repressor protein class G

SCOPe Domain Sequences for d6rx9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6rx9a1 a.4.1.0 (A:3-67) automated matches {Acinetobacter baumannii [TaxId: 509173]}
kldkgtviaaalellnevgmdslttrklaerlkvqqpalywhfqnkralldalaeamlae
rhtrs

SCOPe Domain Coordinates for d6rx9a1:

Click to download the PDB-style file with coordinates for d6rx9a1.
(The format of our PDB-style files is described here.)

Timeline for d6rx9a1:

  • d6rx9a1 is new in SCOPe 2.08-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d6rx9a2