SCOPe 2.07: Domain d1gola_: 1gol A:

Lineage for d1gola_ (1gol A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein MAP kinase Erk2 [56134] (2 species)
   CMGC group; ERK/MAPK subfamily; serine/threonine kinase

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [56136] (57 PDB entries)

8. Domain d1gola_: 1gol A: [41658]
   complexed with atp, mg; mutant

Details for d1gola_

PDB Entry: 1gol, 2.8 Å

PDB Description: coordinates of rat map kinase erk2 with an arginine mutation at position 52

PDB Compounds: (A:) extracellular regulated kinase 2

SCOPe Domain Sequences for d1gola_:

Sequence; same for both SEQRES and ATOM records:

>d1gola_ d.144.1.7 (A:) MAP kinase Erk2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
aaaaaagpemvrgqvfdvgprytnlsyigegaygmvcsaydnlnkvrvairkispfehqt
ycqrtlreikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsn
dhicyflyqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgf
lteyvatrwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgi
lgspsqedlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrie
veqalahpyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqpgyrs

Timeline for d1gola_:

• d1gola_ first appeared (with stable ids) in SCOP 1.55, called d1gol__
  
• d1gola_ appears in SCOPe 2.06
  
• d1gola_ appears in the current release, SCOPe 2.08