![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein MAP kinase Erk2 [56134] (2 species) CMGC group; ERK/MAPK subfamily; serine/threonine kinase |
![]() | Species Rat (Rattus norvegicus) [TaxId:10116] [56136] (6 PDB entries) |
![]() | Domain d1gola_: 1gol A: [41658] complexed with atp, mg; mutant |
PDB Entry: 1gol (more details), 2.8 Å
SCOP Domain Sequences for d1gola_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gola_ d.144.1.7 (A:) MAP kinase Erk2 {Rat (Rattus norvegicus) [TaxId: 10116]} aaaaaagpemvrgqvfdvgprytnlsyigegaygmvcsaydnlnkvrvairkispfehqt ycqrtlreikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsn dhicyflyqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgf lteyvatrwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgi lgspsqedlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrie veqalahpyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqpgyrs
Timeline for d1gola_: