SCOP 1.71: Domain d1gol__: 1gol -

Lineage for d1gol__ (1gol -)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (60 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein MAP kinase Erk2 [56134] (2 species)
   CMGC group; ERK/MAPK subfamily; serine/threonine kinase

7. Species Rat (Rattus norvegicus) [TaxId:10116] [56136] (5 PDB entries)

8. Domain d1gol__: 1gol - [41658]
   complexed with atp, mg; mutant

Details for d1gol__

PDB Entry: 1gol, 2.8 Å

PDB Description: coordinates of rat map kinase erk2 with an arginine mutation at position 52

SCOP Domain Sequences for d1gol__:

Sequence; same for both SEQRES and ATOM records:

>d1gol__ d.144.1.7 (-) MAP kinase Erk2 {Rat (Rattus norvegicus)}
aaaaaagpemvrgqvfdvgprytnlsyigegaygmvcsaydnlnkvrvairkispfehqt
ycqrtlreikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsn
dhicyflyqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgf
lteyvatrwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgi
lgspsqedlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrie
veqalahpyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqpgyrs

Timeline for d1gol__:

• d1gol__ first appeared (with stable ids) in SCOP 1.55
  
• d1gol__ appears in SCOP 1.69
  
• d1gol__ is called d1gola_ in SCOP 1.73
  
• d1gol__ appears in the current release, SCOPe 2.08, called d1gola_