Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily) core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane |
Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) Pfam PF13853. Phylogeny described in PubMed 12761335 |
Family f.13.1.0: automated matches [227143] (1 protein) not a true family |
Protein automated matches [226845] (25 species) not a true protein |
Species Dokdonia eikasta [TaxId:308116] [368258] (36 PDB entries) |
Domain d6rf6a1: 6rf6 A:8-273 [416561] automated match to d6rf7a_ complexed with lfa, na, ret |
PDB Entry: 6rf6 (more details), 1.8 Å
SCOPe Domain Sequences for d6rf6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6rf6a1 f.13.1.0 (A:8-273) automated matches {Dokdonia eikasta [TaxId: 308116]} anfenfigategfseiayqftshiltlgyavmlagllyfiltiknvdkkfqmsnilsavv mvsaflllyaqaqnwtssftfneevgryfldpsgdlfnngyrylnwlidvpmllfqilfv vslttskfssvrnqfwfsgammiitgyigqfyevsnltaflvwgaissafffhilwvmkk vinegkegispagqkilsniwilfliswtlypgaylmpyltgvdgflysedgvmarqlvy tiadvsskviygvllgnlaitlsknk
Timeline for d6rf6a1: