Lineage for d2erka_ (2erk A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734668Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 734669Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 734710Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 735276Protein MAP kinase Erk2 [56134] (2 species)
    CMGC group; ERK/MAPK subfamily; serine/threonine kinase
  7. 735279Species Rat (Rattus norvegicus) [TaxId:10116] [56136] (6 PDB entries)
  8. 735281Domain d2erka_: 2erk A: [41655]

Details for d2erka_

PDB Entry: 2erk (more details), 2.4 Å

PDB Description: phosphorylated map kinase erk2
PDB Compounds: (A:) extracellular signal-regulated kinase 2

SCOP Domain Sequences for d2erka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2erka_ d.144.1.7 (A:) MAP kinase Erk2 {Rat (Rattus norvegicus) [TaxId: 10116]}
aagpemvrgqvfdvgprytnlsyigegaygmvcsaydnlnkvrvaikkispfehqtycqr
tlreikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhic
yflyqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgfltey
vatrwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgsp
sqedlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqa
lahpyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqpgyrs

SCOP Domain Coordinates for d2erka_:

Click to download the PDB-style file with coordinates for d2erka_.
(The format of our PDB-style files is described here.)

Timeline for d2erka_: