Lineage for d6rezb_ (6rez B:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3022990Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
    core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane
  4. 3022991Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) (S)
    Pfam PF13853. Phylogeny described in PubMed 12761335
  5. 3023317Family f.13.1.0: automated matches [227143] (1 protein)
    not a true family
  6. 3023318Protein automated matches [226845] (25 species)
    not a true protein
  7. 3023325Species Dokdonia eikasta [TaxId:308116] [368258] (36 PDB entries)
  8. 3023416Domain d6rezb_: 6rez B: [416536]
    automated match to d6rf7a_
    complexed with lfa, na, olc, ret

Details for d6rezb_

PDB Entry: 6rez (more details), 2.6 Å

PDB Description: crystal structure of the light-driven sodium pump kr2 in the pentameric form, ph 5.0
PDB Compounds: (B:) Sodium pumping rhodopsin

SCOPe Domain Sequences for d6rezb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6rezb_ f.13.1.0 (B:) automated matches {Dokdonia eikasta [TaxId: 308116]}
qelgnanfenfigategfseiayqftshiltlgyavmlagllyfiltiknvdkkfqmsni
lsavvmvsaflllyaqaqnwtssftfneevgryfldpsgdlfnngyrylnwlidvpmllf
qilfvvslttskfssvrnqfwfsgammiitgyigqfyevsnltaflvwgaissafffhil
wvmkkvinegkegispagqkilsniwilfliswtlypgaylmpyltgvdgflysedgvma
rqlvytiadvsskviygvllgnlaitlsknkel

SCOPe Domain Coordinates for d6rezb_:

Click to download the PDB-style file with coordinates for d6rezb_.
(The format of our PDB-style files is described here.)

Timeline for d6rezb_:

  • d6rezb_ is new in SCOPe 2.08-stable