![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein MAP kinase p38-gamma [56132] (1 species) CMGC group; ERK/MAPK subfamily; serine/threonine kinase |
![]() | Species Human (Homo sapiens) [TaxId:9606] [56133] (1 PDB entry) |
![]() | Domain d1cm8b_: 1cm8 B: [41652] phosphorylated complexed with anp, mg |
PDB Entry: 1cm8 (more details), 2.4 Å
SCOPe Domain Sequences for d1cm8b_:
Sequence, based on SEQRES records: (download)
>d1cm8b_ d.144.1.7 (B:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} rsgfyrqevtktawevravyrdlqpvgsgaygavcsavdgrtgakvaikklyrpfqself akrayrelrllkhmrhenviglldvftpdetlddftdfylvmpfmgtdlgklmkheklge driqflvyqmlkglryihaagiihrdlkpgnlavnedcelkildfglarqadsemtgyvv trwyrapevilnwmrytqtvdiwsvgcimaemitgktlfkgsdhldqlkeimkvtgtppa efvqrlqsdeaknymkglpelekkdfasiltnasplavnllekmlvldaeqrvtageala hpyfeslhdtedepqvqkyddsfddvdrtldewkrvtykevlsfkp
>d1cm8b_ d.144.1.7 (B:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} rsgfyrqevtktawevravyrdlqpvavcsavdgrtgakvaikklyrpfqselfakrayr elrllkhmrhenviglldvftpdetlddftdfylvmpfmgtdlgklmkheklgedriqfl vyqmlkglryihaagiihrdlkpgnlavnedcelkildfglarqadsemtgyvvtrwyra pevilnwmrytqtvdiwsvgcimaemitgktlfkgsdhldqlkeimkvtgtppaefvqrl qsdeaknymkglpelekkdfasiltnasplavnllekmlvldaeqrvtagealahpyfes lhqvqkyddsrtldewkrvtykevlsfkp
Timeline for d1cm8b_: