Lineage for d1cm8b_ (1cm8 B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2544477Protein MAP kinase p38-gamma [56132] (1 species)
    CMGC group; ERK/MAPK subfamily; serine/threonine kinase
  7. 2544478Species Human (Homo sapiens) [TaxId:9606] [56133] (1 PDB entry)
  8. 2544480Domain d1cm8b_: 1cm8 B: [41652]
    phosphorylated
    complexed with anp, mg

Details for d1cm8b_

PDB Entry: 1cm8 (more details), 2.4 Å

PDB Description: phosphorylated map kinase p38-gamma
PDB Compounds: (B:) phosphorylated map kinase p38-gamma

SCOPe Domain Sequences for d1cm8b_:

Sequence, based on SEQRES records: (download)

>d1cm8b_ d.144.1.7 (B:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]}
rsgfyrqevtktawevravyrdlqpvgsgaygavcsavdgrtgakvaikklyrpfqself
akrayrelrllkhmrhenviglldvftpdetlddftdfylvmpfmgtdlgklmkheklge
driqflvyqmlkglryihaagiihrdlkpgnlavnedcelkildfglarqadsemtgyvv
trwyrapevilnwmrytqtvdiwsvgcimaemitgktlfkgsdhldqlkeimkvtgtppa
efvqrlqsdeaknymkglpelekkdfasiltnasplavnllekmlvldaeqrvtageala
hpyfeslhdtedepqvqkyddsfddvdrtldewkrvtykevlsfkp

Sequence, based on observed residues (ATOM records): (download)

>d1cm8b_ d.144.1.7 (B:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]}
rsgfyrqevtktawevravyrdlqpvavcsavdgrtgakvaikklyrpfqselfakrayr
elrllkhmrhenviglldvftpdetlddftdfylvmpfmgtdlgklmkheklgedriqfl
vyqmlkglryihaagiihrdlkpgnlavnedcelkildfglarqadsemtgyvvtrwyra
pevilnwmrytqtvdiwsvgcimaemitgktlfkgsdhldqlkeimkvtgtppaefvqrl
qsdeaknymkglpelekkdfasiltnasplavnllekmlvldaeqrvtagealahpyfes
lhqvqkyddsrtldewkrvtykevlsfkp

SCOPe Domain Coordinates for d1cm8b_:

Click to download the PDB-style file with coordinates for d1cm8b_.
(The format of our PDB-style files is described here.)

Timeline for d1cm8b_: