Lineage for d1cm8a_ (1cm8 A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36268Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 36269Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (4 families) (S)
  5. 36270Family d.144.1.1: Serine/threonin kinases [56113] (15 proteins)
  6. 36358Protein MAP kinase p38-gamma [56132] (1 species)
  7. 36359Species Human (Homo sapiens) [TaxId:9606] [56133] (1 PDB entry)
  8. 36360Domain d1cm8a_: 1cm8 A: [41651]

Details for d1cm8a_

PDB Entry: 1cm8 (more details), 2.4 Å

PDB Description: phosphorylated map kinase p38-gamma

SCOP Domain Sequences for d1cm8a_:

Sequence, based on SEQRES records: (download)

>d1cm8a_ d.144.1.1 (A:) MAP kinase p38-gamma {Human (Homo sapiens)}
rsgfyrqevtktawevravyrdlqpvgsgaygavcsavdgrtgakvaikklyrpfqself
akrayrelrllkhmrhenviglldvftpdetlddftdfylvmpfmgtdlgklmkheklge
driqflvyqmlkglryihaagiihrdlkpgnlavnedcelkildfglarqadsemtgyvv
trwyrapevilnwmrytqtvdiwsvgcimaemitgktlfkgsdhldqlkeimkvtgtppa
efvqrlqsdeaknymkglpelekkdfasiltnasplavnllekmlvldaeqrvtageala
hpyfeslhdtedepqvqkyddsfddvdrtldewkrvtykevlsfkp

Sequence, based on observed residues (ATOM records): (download)

>d1cm8a_ d.144.1.1 (A:) MAP kinase p38-gamma {Human (Homo sapiens)}
rsgfyrqevtktawevravyrdlqpvavcsavdgrtgakvaikklyrpfqselfakrayr
elrllkhmrhenviglldvftpdetlddftdfylvmpfmgtdlgklmkheklgedriqfl
vyqmlkglryihaagiihrdlkpgnlavnedcelkildfglarqadsemtgyvvtrwyra
pevilnwmrytqtvdiwsvgcimaemitgktlfkgsdhldqlkeimkvtgtppaefvqrl
qsdeaknymkglpelekkdfasiltnasplavnllekmlvldaeqrvtagealahpyfes
lhqvqkyddsrtldewkrvtykevlsfkp

SCOP Domain Coordinates for d1cm8a_:

Click to download the PDB-style file with coordinates for d1cm8a_.
(The format of our PDB-style files is described here.)

Timeline for d1cm8a_: