Lineage for d1p38__ (1p38 -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36268Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 36269Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (4 families) (S)
  5. 36270Family d.144.1.1: Serine/threonin kinases [56113] (15 proteins)
  6. 36347Protein MAP kinase p38 [56129] (2 species)
  7. 36356Species Mouse (Mus musculus) [TaxId:10090] [56131] (1 PDB entry)
  8. 36357Domain d1p38__: 1p38 - [41650]

Details for d1p38__

PDB Entry: 1p38 (more details), 2.1 Å

PDB Description: the structure of the map kinase p38 at 2.1 angstoms resolution

SCOP Domain Sequences for d1p38__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p38__ d.144.1.1 (-) MAP kinase p38 {Mouse (Mus musculus)}
erptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktghrvavkklsrpfqsii
hakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqklt
ddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyv
atrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpg
aellkkissesarnyiqslaqmpkmnfanvfiganplavdllekmlvldsdkritaaqal
ahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppld

SCOP Domain Coordinates for d1p38__:

Click to download the PDB-style file with coordinates for d1p38__.
(The format of our PDB-style files is described here.)

Timeline for d1p38__: