Lineage for d1di9a_ (1di9 A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36268Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 36269Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (4 families) (S)
  5. 36270Family d.144.1.1: Serine/threonin kinases [56113] (15 proteins)
  6. 36347Protein MAP kinase p38 [56129] (2 species)
  7. 36348Species Human (Homo sapiens) [TaxId:9606] [56130] (7 PDB entries)
  8. 36355Domain d1di9a_: 1di9 A: [41649]

Details for d1di9a_

PDB Entry: 1di9 (more details), 2.6 Å

PDB Description: the structure of p38 mitogen-activated protein kinase in complex with 4-[3-methylsulfanylanilino]-6,7-dimethoxyquinazoline

SCOP Domain Sequences for d1di9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1di9a_ d.144.1.1 (A:) MAP kinase p38 {Human (Homo sapiens)}
erptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsii
hakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqklt
ddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyv
atrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpg
aellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqal
ahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpp

SCOP Domain Coordinates for d1di9a_:

Click to download the PDB-style file with coordinates for d1di9a_.
(The format of our PDB-style files is described here.)

Timeline for d1di9a_: