Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [226022] (18 PDB entries) |
Domain d6qn8d_: 6qn8 D: [416485] Other proteins in same PDB: d6qn8a2, d6qn8a3, d6qn8c2, d6qn8e2, d6qn8g2, d6qn8h2, d6qn8j2 automated match to d6shgl_ complexed with cl |
PDB Entry: 6qn8 (more details), 2.12 Å
SCOPe Domain Sequences for d6qn8d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6qn8d_ b.1.1.0 (D:) automated matches {Cow (Bos taurus) [TaxId: 9913]} vltqppsvsgslgqrvsitcsgssdnigifavgwyqqvpgsglrtiiygntkrpsgvpdr fsgsksgntatltinslqaedeadyfcvcgesksatpvfgggttltvlgqpksppsvtlf ppsteelngnkatlvclisdfypgsvtvvwkadgstitrnvettraskqsnskyaassyl sltssdwkskgsyscevthegstvtktvkpsec
Timeline for d6qn8d_: