Lineage for d6qn8d_ (6qn8 D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754143Species Cow (Bos taurus) [TaxId:9913] [226022] (18 PDB entries)
  8. 2754168Domain d6qn8d_: 6qn8 D: [416485]
    Other proteins in same PDB: d6qn8a2, d6qn8a3, d6qn8c2, d6qn8e2, d6qn8g2, d6qn8h2, d6qn8j2
    automated match to d6shgl_
    complexed with cl

Details for d6qn8d_

PDB Entry: 6qn8 (more details), 2.12 Å

PDB Description: structure of bovine anti-rsv fab b13
PDB Compounds: (D:) Light chain of bovine anti-RSV Fab B13

SCOPe Domain Sequences for d6qn8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6qn8d_ b.1.1.0 (D:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
vltqppsvsgslgqrvsitcsgssdnigifavgwyqqvpgsglrtiiygntkrpsgvpdr
fsgsksgntatltinslqaedeadyfcvcgesksatpvfgggttltvlgqpksppsvtlf
ppsteelngnkatlvclisdfypgsvtvvwkadgstitrnvettraskqsnskyaassyl
sltssdwkskgsyscevthegstvtktvkpsec

SCOPe Domain Coordinates for d6qn8d_:

Click to download the PDB-style file with coordinates for d6qn8d_.
(The format of our PDB-style files is described here.)

Timeline for d6qn8d_:

  • d6qn8d_ is new in SCOPe 2.08-stable