Lineage for d6qn7l_ (6qn7 L:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754143Species Cow (Bos taurus) [TaxId:9913] [226022] (18 PDB entries)
  8. 2754180Domain d6qn7l_: 6qn7 L: [416478]
    Other proteins in same PDB: d6qn7a2, d6qn7h2
    automated match to d6shgl_

Details for d6qn7l_

PDB Entry: 6qn7 (more details), 2.15 Å

PDB Description: structure of bovine anti-rsv hybrid fab b4hc-b13lc
PDB Compounds: (L:) Light chain of bovine anti-RSV B13

SCOPe Domain Sequences for d6qn7l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6qn7l_ b.1.1.0 (L:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
vltqppsvsgslgqrvsitcsgssdnigifavgwyqqvpgsglrtiiygntkrpsgvpdr
fsgsksgntatltinslqaedeadyfcvcgesksatpvfgggttltvlgqpksppsvtlf
ppsteelngnkatlvclisdfypgsvtvvwkadgstitrnvettraskqsnskyaassyl
sltssdwkskgsyscevthegstvtktvkpsec

SCOPe Domain Coordinates for d6qn7l_:

Click to download the PDB-style file with coordinates for d6qn7l_.
(The format of our PDB-style files is described here.)

Timeline for d6qn7l_:

  • d6qn7l_ is new in SCOPe 2.08-stable