Lineage for d1bl6a_ (1bl6 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2982128Protein MAP kinase p38 [56129] (2 species)
    CMGC group; ERK/MAPK subfamily; serine/threonine kinase
  7. 2982129Species Human (Homo sapiens) [TaxId:9606] [56130] (204 PDB entries)
  8. 2982269Domain d1bl6a_: 1bl6 A: [41647]
    complexed with sb6

Details for d1bl6a_

PDB Entry: 1bl6 (more details), 2.5 Å

PDB Description: the complex structure of the map kinase p38/sb216995
PDB Compounds: (A:) protein (map kinase p38)

SCOPe Domain Sequences for d1bl6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bl6a_ d.144.1.7 (A:) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]}
erptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsii
hakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqklt
ddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyv
atrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpg
aellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqal
ahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppld

SCOPe Domain Coordinates for d1bl6a_:

Click to download the PDB-style file with coordinates for d1bl6a_.
(The format of our PDB-style files is described here.)

Timeline for d1bl6a_: