Lineage for d1a9u__ (1a9u -)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 611837Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 611838Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 611879Family d.144.1.7: Protein kinases, catalytic subunit [88854] (60 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 612300Protein MAP kinase p38 [56129] (2 species)
    CMGC group; ERK/MAPK subfamily; serine/threonine kinase
  7. 612301Species Human (Homo sapiens) [TaxId:9606] [56130] (16 PDB entries)
  8. 612308Domain d1a9u__: 1a9u - [41646]
    complexed with sb2; mutant

Details for d1a9u__

PDB Entry: 1a9u (more details), 2.5 Å

PDB Description: the complex structure of the map kinase p38/sb203580

SCOP Domain Sequences for d1a9u__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a9u__ d.144.1.7 (-) MAP kinase p38 {Human (Homo sapiens)}
erptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsii
hakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqklt
ddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyv
atrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpg
aellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqal
ahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppld

SCOP Domain Coordinates for d1a9u__:

Click to download the PDB-style file with coordinates for d1a9u__.
(The format of our PDB-style files is described here.)

Timeline for d1a9u__: