SCOP 1.69: Domain d1a9u__: 1a9u -

Lineage for d1a9u__ (1a9u -)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (53 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein MAP kinase p38 [56129] (2 species)
   CMGC group; ERK/MAPK subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [56130] (16 PDB entries)

8. Domain d1a9u__: 1a9u - [41646]

Details for d1a9u__

PDB Entry: 1a9u, 2.5 Å

PDB Description: the complex structure of the map kinase p38/sb203580

SCOP Domain Sequences for d1a9u__:

Sequence; same for both SEQRES and ATOM records:

>d1a9u__ d.144.1.7 (-) MAP kinase p38 {Human (Homo sapiens)}
erptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsii
hakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqklt
ddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyv
atrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpg
aellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqal
ahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppld

Timeline for d1a9u__:

• d1a9u__ first appeared (with stable ids) in SCOP 1.55
  
• d1a9u__ appears in SCOP 1.67
  
• d1a9u__ appears in SCOP 1.71
  
• d1a9u__ appears in the current release, SCOPe 2.08, called d1a9ua_