Lineage for d6pgkq_ (6pgk Q:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026109Superfamily f.23.16: Subunit III of photosystem I reaction centre, PsaF [81536] (2 families) (S)
    automatically mapped to Pfam PF02507
  5. 3026110Family f.23.16.1: Subunit III of photosystem I reaction centre, PsaF [81535] (2 proteins)
  6. 3026111Protein Subunit III of photosystem I reaction centre, PsaF [81534] (2 species)
  7. 3026114Species Thermosynechococcus elongatus [TaxId:197221] [420047] (1 PDB entry)
  8. 3026116Domain d6pgkq_: 6pgk Q: [416444]
    Other proteins in same PDB: d6pgka_, d6pgkb_, d6pgkc_, d6pgkd_, d6pgke_, d6pgkg_, d6pgkh_, d6pgki_, d6pgkj_, d6pgkl_, d6pgkm_, d6pgkn_, d6pgko_, d6pgkp_, d6pgkr_, d6pgks_, d6pgku_, d6pgkv_, d6pgkw_, d6pgkx_, d6pgky_, d6pgkz_
    automated match to d1jb0f_
    complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4

Details for d6pgkq_

PDB Entry: 6pgk (more details), 2.9 Å

PDB Description: membrane protein megahertz crystallography at the european xfel, photosystem i xfel at 2.9 a
PDB Compounds: (Q:) Photosystem I reaction center subunit III

SCOPe Domain Sequences for d6pgkq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pgkq_ f.23.16.1 (Q:) Subunit III of photosystem I reaction centre, PsaF {Thermosynechococcus elongatus [TaxId: 197221]}
dvaglvpckdspafqkraaaavnttadpasgqkrferysqalcgedglphlvvdgrlsra
gdflipsvlflyiagwigwvgrayliavrnsgeanekeiiidvplaikcmltgfawplaa
lkelasgeltakdneitvspr

SCOPe Domain Coordinates for d6pgkq_:

Click to download the PDB-style file with coordinates for d6pgkq_.
(The format of our PDB-style files is described here.)

Timeline for d6pgkq_:

  • d6pgkq_ is new in SCOPe 2.08-stable