Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.17: Subunit VIII of photosystem I reaction centre, PsaI [81540] (1 family) |
Family f.23.17.1: Subunit VIII of photosystem I reaction centre, PsaI [81539] (2 proteins) |
Protein Subunit VIII of photosystem I reaction centre, PsaI [81538] (2 species) |
Species Thermosynechococcus elongatus [TaxId:197221] [377780] (5 PDB entries) |
Domain d6pgki_: 6pgk I: [416437] Other proteins in same PDB: d6pgka_, d6pgkb_, d6pgkc_, d6pgkd_, d6pgke_, d6pgkf_, d6pgkg_, d6pgkh_, d6pgkj_, d6pgkl_, d6pgkm_, d6pgkn_, d6pgko_, d6pgkp_, d6pgkq_, d6pgks_, d6pgku_, d6pgkv_, d6pgkw_, d6pgkx_, d6pgky_, d6pgkz_ automated match to d1jb0i_ complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4 |
PDB Entry: 6pgk (more details), 2.9 Å
SCOPe Domain Sequences for d6pgki_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6pgki_ f.23.17.1 (I:) Subunit VIII of photosystem I reaction centre, PsaI {Thermosynechococcus elongatus [TaxId: 197221]} mmgsyaasflpwifipvvcwlmptvvmgllflyiegea
Timeline for d6pgki_: