Lineage for d1wfc__ (1wfc -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36268Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 36269Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (4 families) (S)
  5. 36270Family d.144.1.1: Serine/threonin kinases [56113] (15 proteins)
  6. 36347Protein MAP kinase p38 [56129] (2 species)
  7. 36348Species Human (Homo sapiens) [TaxId:9606] [56130] (7 PDB entries)
  8. 36349Domain d1wfc__: 1wfc - [41643]

Details for d1wfc__

PDB Entry: 1wfc (more details), 2.3 Å

PDB Description: structure of apo, unphosphorylated, p38 mitogen activated protein kinase p38 (p38 map kinase) the mammalian homologue of the yeast hog1 protein

SCOP Domain Sequences for d1wfc__:

Sequence, based on SEQRES records: (download)

>d1wfc__ d.144.1.1 (-) MAP kinase p38 {Human (Homo sapiens)}
rptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsiih
akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltd
dhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyva
trwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpga
ellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqala
hayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpp

Sequence, based on observed residues (ATOM records): (download)

>d1wfc__ d.144.1.1 (-) MAP kinase p38 {Human (Homo sapiens)}
rptfyrqeltiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsiihak
rtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltddh
vqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildftddemtgyvatrwyrap
eimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkis
sesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqy
hdpddepvadpydqsfesrdllidewksltydevisfvpp

SCOP Domain Coordinates for d1wfc__:

Click to download the PDB-style file with coordinates for d1wfc__.
(The format of our PDB-style files is described here.)

Timeline for d1wfc__: